PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00014.1.g02500.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 578aa    MW: 62799.4 Da    PI: 6.4161
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00014.1.g02500.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS344.61.7e-1052095783374
                          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalk 82 
                                   + Ll+c +  +  d+ la   L +++  a  dgdp +R+a+yf+ ALa+rla   + + ++a+ ++ +    s+e +  +k
  Zjn_sc00014.1.g02500.1.am.mk 209 QSLLACSRTAA-ADAGLAAVQLVKVRAAAFDDGDPAERVAFYFADALARRLACdGGARPSSAVDCRFA----SDELTLCYK 284
                                   78999999655.58999999999*****************************9444555555555555....699999*** PP

                          GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeelee 160
                                   ++++++P+ kf+hltaNqaIleav  ++++Hi+Df+i qG+QW+aLlqaL++Rpeg+p ++Ri gv sp  g   + +l +
  Zjn_sc00014.1.g02500.1.am.mk 285 TLNDACPYSKFAHLTANQAILEAVGAATKIHIVDFGIVQGIQWAALLQALTTRPEGKPsRVRISGVPSPFLGskPTASLAA 365
                                   ******************************************************887769********9887889999*** PP

                          GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                                   t  rL++fA+ lgv+fef + + + +++l  +++ v+++E++aVn++lql++lld++ ++ +   +vL+l ksl+P vv++
  Zjn_sc00014.1.g02500.1.am.mk 366 TSARLRDFAKLLGVDFEFVP-LLRPVHELGRSDFLVERDETVAVNFMLQLYHLLDDTDEQVK---RVLRLAKSLNPSVVTL 442
                                   ********************.599******************************88888888...**************** PP

                          GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva.cegaerrerhetlekWrerlee 321
                                    e e+++n+  F++rf++al yy+++f+sl++ ++r+s er+ vEr ++g++i+ ++   egaer+ r+   ++W+  +e 
  Zjn_sc00014.1.g02500.1.am.mk 443 GEYEVSLNRVGFVDRFANALCYYMSVFESLDVAMARNSPERARVERCMFGERIRRAIGlEEGAERTDRMAGCREWHTLMEW 523
                                   *********************************************************7267899***************** PP

                          GRAS 322 aGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                                   +GF+pv+ls++a++qa+lll +++ +  y++ e++ +++ l W++rpL++vS+Wr
  Zjn_sc00014.1.g02500.1.am.mk 524 CGFEPVRLSNYAMSQADLLLWNYDsKYKYSLVERKPAFLsLAWEKRPLLTVSVWR 578
                                   ************************77789999***99999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.612181556IPR005202Transcription factor GRAS
PfamPF035145.8E-103209578IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
LNSSAASRPH RPPFHDSATG DGGGRRMAYM CADSGNLMAI AQQVIQQQQQ QQHQRHHHHH  60
LPPIPMPPRH APPGQALPHG QIPAASYGGG AWPHSEHFFA DAFVGAPPAA DAVFSDISGA  120
VDFDSDGWME SLIAEAPVFA DSDLDHLIFT TPPPPVPVAA PAPEPVEAAA SLQPKAAAPV  180
SVPQPATATP TACSSPNSLD ASCSAPILQS LLACSRTAAA DAGLAAVQLV KVRAAAFDDG  240
DPAERVAFYF ADALARRLAC DGGARPSSAV DCRFASDELT LCYKTLNDAC PYSKFAHLTA  300
NQAILEAVGA ATKIHIVDFG IVQGIQWAAL LQALTTRPEG KPSRVRISGV PSPFLGSKPT  360
ASLAATSARL RDFAKLLGVD FEFVPLLRPV HELGRSDFLV ERDETVAVNF MLQLYHLLDD  420
TDEQVKRVLR LAKSLNPSVV TLGEYEVSLN RVGFVDRFAN ALCYYMSVFE SLDVAMARNS  480
PERARVERCM FGERIRRAIG LEEGAERTDR MAGCREWHTL MEWCGFEPVR LSNYAMSQAD  540
LLLWNYDSKY KYSLVERKPA FLSLAWEKRP LLTVSVWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A0.02045781375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466548.10.0hypothetical protein SORBIDRAFT_01g009740
SwissprotQ9FL031e-150SCL4_ARATH; Scarecrow-like protein 4
TrEMBLC5WMW50.0C5WMW5_SORBI; Putative uncharacterized protein Sb01g009740
STRINGSb01g009740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85693748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-142GRAS family protein